Iright
BRAND / VENDOR: Proteintech

Proteintech, 16687-1-AP, Cytohesin 3 Polyclonal antibody

CATALOG NUMBER: 16687-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cytohesin 3 (16687-1-AP) by Proteintech is a Polyclonal antibody targeting Cytohesin 3 in WB, ELISA applications with reactivity to human, mouse, rat samples 16687-1-AP targets Cytohesin 3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Cytohesin 3 (CYTH3), also known as GRP1, ARNO3, or PSCD3, is a member of the PSCD family of guanine nucleotide exchange factors (GEFs) that regulate ADP-ribosylation factor (ARF) GTPases. Through its Sec7 domain, CYTH3 facilitates the exchange of GDP for GTP on ARF proteins, thereby modulating vesicle biogenesis, protein sorting, and Golgi apparatus structure and function. Clinicopathological studies demonstrate that CYTH3 is significantly upregulated in hepatocellular carcinoma (HCC) and negatively correlates with patient survival. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10025 Product name: Recombinant human CYTH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-399 aa of BC008191 Sequence: MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK Predict reactive species Full Name: cytohesin 3 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC008191 Gene Symbol: Cytohesin 3 Gene ID (NCBI): 9265 RRID: AB_2261396 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43739 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924