Iright
BRAND / VENDOR: Proteintech

Proteintech, 16691-1-AP, GPR180 Polyclonal antibody

CATALOG NUMBER: 16691-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR180 (16691-1-AP) by Proteintech is a Polyclonal antibody targeting GPR180 in WB, ELISA applications with reactivity to human samples 16691-1-AP targets GPR180 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information GPR180 is an orphan GPCR, also known as the Endothelial Thickness-Related Receptor (ITR), and is a member of the GOLDS domain seven transmembrane helix (GOST) protein family. This receptor was initially discovered to promote the proliferation of vascular smooth muscle cells, leading to subsequent thickening of the vascular intima. GPR180 interacts with CTHRC1 to regulate the TGFβ signaling pathway, influencing energy metabolism and thermogenic function ( PMID: 34880217). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10052 Product name: Recombinant human GPR180 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-170 aa of BC052243 Sequence: QGSQGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGESGL Predict reactive species Full Name: G protein-coupled receptor 180 Calculated Molecular Weight: 440 aa, 49 kDa GenBank Accession Number: BC052243 Gene Symbol: GPR180 Gene ID (NCBI): 160897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86V85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924