Proteintech, 16705-1-AP, MTH1 Polyclonal antibody

Size: 20ul / 150ul The MTH1 (16705-1-AP) by Proteintech is a Polyclonal antibody targeting MTH1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16705-1-AP targets MTH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, Jurkat cells, PC-3 cells Positive IHC detected in: human lung cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information MTH1, also known as NUDT1 or 8-Oxo-dGTPase, is an important repair enzyme that prevents oxidative stress-induced DNA damage through hydrolyzing mutagenic 8-oxo-dGTP into 8-oxo-dGMP. MTH1 is expressed in postmitotic neurons as well as in proliferative tissues, and it is localized both in the mitochondria and nucleus. MTH1 might be a useful marker of oxidative stress and its level increased upon oxidative stress. Increased expression of MTH1 were also found in various cancer tissues and neurodegenerative diseases. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10103 Product name: Recombinant human NUDT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC014618 Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 1 Calculated Molecular Weight: 179aa,20 kDa; 197aa,23 kDa Observed Molecular Weight: 18-24 kDa GenBank Accession Number: BC014618 Gene Symbol: MTH1 Gene ID (NCBI): 4521 RRID: AB_2153822 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36639 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.