Iright
BRAND / VENDOR: Proteintech

Proteintech, 16715-1-AP, NPL Polyclonal antibody

CATALOG NUMBER: 16715-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPL (16715-1-AP) by Proteintech is a Polyclonal antibody targeting NPL in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16715-1-AP targets NPL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, Raji cells, rat brain tissue, rat kidney tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The N-acetylneuraminate lyase(NPL) from human (hNAL) which consists of 320 amino acids, has a molecular mass of 35.2 kDa and it catalyses the reversible aldol reaction of sialic acid, and has been extensively used in the synthesis of sialic acids and its analogues(PMID:19057931). The enzyme is widely distributed and are present in numerous pro- and eukaryotic cells, in which they are localized only in the cytosol(PMID:12453637). It belongs to the DHDPS family and has 5 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10137 Product name: Recombinant human NPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC058003 Sequence: MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQ Predict reactive species Full Name: N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) Calculated Molecular Weight: 27 kDa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC058003 Gene Symbol: NPL Gene ID (NCBI): 80896 RRID: AB_2154866 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924