Proteintech, 16719-1-AP, OBFC2A Polyclonal antibody

Size: 20ul / 150ul The OBFC2A (16719-1-AP) by Proteintech is a Polyclonal antibody targeting OBFC2A in WB, ELISA applications with reactivity to human, mouse, rat samples 16719-1-AP targets OBFC2A in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Single-stranded DNA (ssDNA)-binding proteins (SSBs) are ubiquitous and essential for a variety of DNA metabolic processes, including recombination, replication, and detection and repair of damage. SSBs have multiple roles in binding and sequestering ssDNA, detecting DNA damage, stimulating nucleases, helicases and strand-exchange proteins, activating transcription and mediating protein-protein interactions [PMID:18449195] Human single-stranded DNA-binding protein 1 (hSSB1), encoded by OBFC2B, is characterized as an essential factor for the initiation of DNA damage checkpoints and the maintenance of genomic stability [PMID:22940690]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10158 Product name: Recombinant human OBFC2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC107723 Sequence: MWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR Predict reactive species Full Name: oligonucleotide/oligosaccharide-binding fold containing 2A Calculated Molecular Weight: 124 aa, 14 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC107723 Gene Symbol: OBFC2A Gene ID (NCBI): 64859 RRID: AB_2156021 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AH0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.