Proteintech, 16721-1-AP, SAA Polyclonal antibody

Size: 20ul / 150ul The SAA (16721-1-AP) by Proteintech is a Polyclonal antibody targeting SAA in IHC, ELISA applications with reactivity to human samples 16721-1-AP targets SAA in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human liver tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Serum amyloid A1(SAA1) is a member of the serum amyloid A family of apolipoproteins. SAA1 is an acute phase apolipoprotein reactant produced mainly by hepatocytes and under regulation of inflammatory cytokines. Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA1 protein. Elevated serum SAA1 protein levels may be associated with lung cancer(PMID: 1463770). This antibody can recognize SAA1 and SAA2. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10160 Product name: Recombinant human SAA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-122 aa of BC105796 Sequence: SFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY Predict reactive species Full Name: serum amyloid A1 Calculated Molecular Weight: 122 aa, 14 kDa GenBank Accession Number: BC105796 Gene Symbol: SAA1 Gene ID (NCBI): 6288 RRID: AB_3085507 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0DJI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.