Proteintech, 16722-1-AP, TMEM71 Polyclonal antibody

Size: 20ul / 150ul The TMEM71 (16722-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM71 in IHC, ELISA applications with reactivity to human samples 16722-1-AP targets TMEM71 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TMEM71 is a transmembrane protein which was found to be associated with the glucocorticoids (GC) response status of the Acute Graft-versus-Host Disease (aGvHD) patients. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10161 Product name: Recombinant human TMEM71 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC105783 Sequence: MYRISQLMSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTEDSFLCDKDGNITLNPSQTSVMYKENLVRIFRKKKRICHSFSSLFNLSTSKSWLHGSIFGDINSSPSEDNWLKGTRRLDTDHCNGNETRLL Predict reactive species Full Name: transmembrane protein 71 Calculated Molecular Weight: 232 aa, 26 kDa GenBank Accession Number: BC105783 Gene Symbol: TMEM71 Gene ID (NCBI): 137835 RRID: AB_2878304 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P5X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.