Iright
BRAND / VENDOR: Proteintech

Proteintech, 16735-1-AP, MRPS16 Polyclonal antibody

CATALOG NUMBER: 16735-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPS16 (16735-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS16 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16735-1-AP targets MRPS16 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, HepG2 cells, mouse liver tissue, rat liver tissue Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9749 Product name: Recombinant human MRPS16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC021106 Sequence: MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET Predict reactive species Full Name: mitochondrial ribosomal protein S16 Calculated Molecular Weight: 137 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC021106 Gene Symbol: MRPS16 Gene ID (NCBI): 51021 RRID: AB_2180166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3D3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924