Iright
BRAND / VENDOR: Proteintech

Proteintech, 16773-1-AP, SCUBE3 Polyclonal antibody

CATALOG NUMBER: 16773-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCUBE3 (16773-1-AP) by Proteintech is a Polyclonal antibody targeting SCUBE3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16773-1-AP targets SCUBE3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, TT cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SCUBE3 is a secreted glycoprotein that belongs to the SCUBE family. Members of the SCUBE family are secreted plasma membrane-associated proteins characterised by a N-terminal signal peptide sequence, multiple EGF domains, a N-linked glycosylated spacer region and a C-terminal CUB region. SCUBE3 may play a role in bone cell biology (PMID: 15234972). It may also has a role in the regulation of cardiac growth and remodeling responses (PMID: 17442284). Besides, SCUBE3 has been reported to be involved in lung cancer progression (PMID: 21441952; 23420440). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10085 Product name: Recombinant human SCUBE3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 643-992 aa of BC052263 Sequence: YYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSVDGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCSRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK Predict reactive species Full Name: signal peptide, CUB domain, EGF-like 3 Calculated Molecular Weight: 992 aa, 109 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC052263 Gene Symbol: SCUBE3 Gene ID (NCBI): 222663 RRID: AB_2285430 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IX30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924