Proteintech, 16777-1-AP, NEDD8 Polyclonal antibody

Size: 20ul / 150ul The NEDD8 (16777-1-AP) by Proteintech is a Polyclonal antibody targeting NEDD8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples 16777-1-AP targets NEDD8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: NIH/3T3 cells, human heart tissue, mouse brain tissue, PC-12 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NEDD8 (neural precursor cell-expressed developmentally down-regulated gene 8) is a small ubiquitin-like protein that shares 60% sequence identity and 80% homology with ubiquitin [PMID:9353319]. NEDD8 is conjugated to substrate proteins in a process known as neddylation. NEDD8 forms a thioester bond with APPBP1-Uba3, the E1 enzyme. Activated NEDD8 then transfers to Ubc12, the E2 enzyme . Ultimately, E2 loaded with NEDD8 binds a substrate protein lysine residue and forms an isopeptide bond by E3 ligase [PMID:18802447]. Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10154 Product name: Recombinant human NEDD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC104664 Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ Predict reactive species Full Name: neural precursor cell expressed, developmentally down-regulated 8 Calculated Molecular Weight: 81 aa, 9 kDa Observed Molecular Weight: 6-10 kDa GenBank Accession Number: BC104664 Gene Symbol: NEDD8 Gene ID (NCBI): 4738 RRID: AB_10598467 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15843 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.