Proteintech, 16780-1-AP, DNAJB12 Polyclonal antibody

Size: 20ul / 150ul The DNAJB12 (16780-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB12 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16780-1-AP targets DNAJB12 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, A549 cells, human brain tissue, human kidney tissue, human liver tissue, MCF-7 cells, MKN-45 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human stomach tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information DNAJB12 (JB12), a ER transmembrane chaperone, specifically interacts with Hsc70 to facilitate ER retention and delivery of membrane proteins for folding or degradation in the ERAD pathway. Hsc70 chaperone activities require the substrate targeting function of DNAJB12. DNAJB12 recruits specific substrates to contact Hsc70 and then stimulates its ATPase activity. (PMID: 34668642) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10193 Product name: Recombinant human DNAJB12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-248 aa of BC011812 Sequence: AYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily B, member 12 Calculated Molecular Weight: 375 aa, 42 kDa Observed Molecular Weight: 40-42 kDa GenBank Accession Number: BC011812 Gene Symbol: DNAJB12 Gene ID (NCBI): 54788 RRID: AB_2094404 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXW2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.