Proteintech, 16787-1-AP, MED30 Polyclonal antibody

Size: 20ul / 150ul The MED30 (16787-1-AP) by Proteintech is a Polyclonal antibody targeting MED30 in WB, IP, ELISA applications with reactivity to human, mouse samples 16787-1-AP targets MED30 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human heart tissue, HEK-293 cells Positive IP detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information MED30, also named as THRAP6 and TRAP25, is a component of the Mediator complex. MED30 has two isoforms with MW 16-20 kDa ad 20-25 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10221 Product name: Recombinant human MED30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC008226 Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN Predict reactive species Full Name: mediator complex subunit 30 Calculated Molecular Weight: 178 aa, 20 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC008226 Gene Symbol: MED30 Gene ID (NCBI): 90390 RRID: AB_2142439 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96HR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.