Proteintech, 16788-1-AP, GLOD4 Polyclonal antibody

Size: 20ul / 150ul The GLOD4 (16788-1-AP) by Proteintech is a Polyclonal antibody targeting GLOD4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16788-1-AP targets GLOD4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, human placenta tissue, rat brain tissue Positive IHC detected in: human heart tissue, mouse ovary tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10222 Product name: Recombinant human GLOD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-298 aa of BC008605 Sequence: MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG Predict reactive species Full Name: glyoxalase domain containing 4 Calculated Molecular Weight: 289 aa, 33 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC008605 Gene Symbol: GLOD4 Gene ID (NCBI): 51031 RRID: AB_2247517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC38 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.