Proteintech, 16803-1-AP, ASXL1 Polyclonal antibody

Size: 20ul / 150ul The ASXL1 (16803-1-AP) by Proteintech is a Polyclonal antibody targeting ASXL1 in WB, ELISA applications with reactivity to human samples 16803-1-AP targets ASXL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Additional sex combs-like 1 (ASXL1) is a member of the ASXL family, which is involved in epigenetic regulation. It is one of the mammalian Asx homologs. Mutations in the ASXL1 gene are frequently found in myeloid neoplasms, breast cancers and prostate cancers (PMID: 30013160; PMID: 22436456; PMID: 26470845). In patients with myeloid malignancies, ASXL1 mutations are mostly heterozygous frameshift or nonsense mutations that result in C-terminal truncation (PMID: 30982744; PMID: 26095772; PMID: 32683582; PMID: 29643185). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10290 Product name: Recombinant human ASXL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-84 aa of BC064984 Sequence: MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR Predict reactive species Full Name: additional sex combs like 1 (Drosophila) Calculated Molecular Weight: 84aa,10 kDa; 1541aa,165 kDa Observed Molecular Weight: ~200 kDa GenBank Accession Number: BC064984 Gene Symbol: ASXL1 Gene ID (NCBI): 171023 RRID: AB_3669257 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.