Product Description
Size: 20ul / 150ul
The RPLP2 (16805-1-AP) by Proteintech is a Polyclonal antibody targeting RPLP2 in WB, IHC, ELISA applications with reactivity to human, mouse samples
16805-1-AP targets RPLP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HL-60 cells, mouse liver tissue
Positive IHC detected in: mouse kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag10293 Product name: Recombinant human RPLP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC062314 Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD Predict reactive species
Full Name: ribosomal protein, large, P2
Calculated Molecular Weight: 115 aa, 12 kDa
Observed Molecular Weight: 15 kDa
GenBank Accession Number: BC062314
Gene Symbol: RPLP2
Gene ID (NCBI): 6181
RRID: AB_2878318
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P05387
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924