Iright
BRAND / VENDOR: Proteintech

Proteintech, 16827-1-AP, CNRIP1 Polyclonal antibody

CATALOG NUMBER: 16827-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CNRIP1 (16827-1-AP) by Proteintech is a Polyclonal antibody targeting CNRIP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16827-1-AP targets CNRIP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, human brain tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CNRIP1, also named as C2orf32, has two isoforms with MW 13-25 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10428 Product name: Recombinant human CNRIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC011535 Sequence: MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL Predict reactive species Full Name: cannabinoid receptor interacting protein 1 Calculated Molecular Weight: 164 aa, 19 kDa Observed Molecular Weight: 13-25 kDa GenBank Accession Number: BC011535 Gene Symbol: CNRIP1 Gene ID (NCBI): 25927 RRID: AB_2245126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96F85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924