Iright
BRAND / VENDOR: Proteintech

Proteintech, 16839-1-AP, NIP7 Polyclonal antibody

CATALOG NUMBER: 16839-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NIP7 (16839-1-AP) by Proteintech is a Polyclonal antibody targeting NIP7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 16839-1-AP targets NIP7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Nip7 was initially identified in yeast as required for processing of the 27S pre-rRNA to form the mature 25S and 5.8S rRNAs (PMID: 9891085). It localizes to the nucleolus but was also found to sediment in the region of free 60S subunits in sucrose density gradients (PMID: 9891085). Experimental evidence suggests that the P. abyssi Nip7 may be an exosome regulatory factor. It binds preferentially to U- and AU-rich RNAs and strongly inhibits the exosome due to its association with both the exosome complex and the substrate RNA. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10526 Product name: Recombinant human NIP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC015941 Sequence: MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT Predict reactive species Full Name: nuclear import 7 homolog (S. cerevisiae) Calculated Molecular Weight: 180 aa, 20 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC015941 Gene Symbol: NIP7 Gene ID (NCBI): 51388 RRID: AB_2153549 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924