Proteintech, 16844-1-AP, OAT3/SLC22A8 Polyclonal antibody

Size: 20ul / 150ul The OAT3/SLC22A8 (16844-1-AP) by Proteintech is a Polyclonal antibody targeting OAT3/SLC22A8 in WB, ELISA applications with reactivity to human, mouse, rat samples 16844-1-AP targets OAT3/SLC22A8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information OAT3 (encoded by SLC22A8) is widely distributed in the kidney, liver, choroid plexus, olfactory mucosa, brain, retina, and placenta, but it is pre-dominantly expressed on the basolateral membrane of renal tubular cells. OAT3 plays a crucial role in the uptake, distribution, and excretion of various endogenous/exogenous substances. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9795 Product name: Recombinant human SLC22A8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-123 aa of bc022387 Sequence: MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKE Predict reactive species Full Name: solute carrier family 22 (organic anion transporter), member 8 Calculated Molecular Weight: 542 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: bc022387 Gene Symbol: SLC22A8 Gene ID (NCBI): 9376 RRID: AB_3663018 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TCC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.