Iright
BRAND / VENDOR: Proteintech

Proteintech, 16888-1-AP, MTCH2 Polyclonal antibody

CATALOG NUMBER: 16888-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTCH2 (16888-1-AP) by Proteintech is a Polyclonal antibody targeting MTCH2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, rat samples 16888-1-AP targets MTCH2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat testis tissue Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10399 Product name: Recombinant human MTCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-178 aa of BC000875 Sequence: GYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGF Predict reactive species Full Name: mitochondrial carrier homolog 2 (C. elegans) Calculated Molecular Weight: 303 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC000875 Gene Symbol: MTCH2 Gene ID (NCBI): 23788 RRID: AB_2266733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6C9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924