Iright
BRAND / VENDOR: Proteintech

Proteintech, 16913-1-AP, HLA-G Polyclonal antibody

CATALOG NUMBER: 16913-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HLA-G (16913-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-G in WB, ELISA applications with reactivity to human samples 16913-1-AP targets HLA-G in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). HLA-G is a non-classical MHC class I molecule with multiple immunoregulatory properties. HLA-G exhibits a restricted pattern of expression that includes placental extravillous trophoblasts at the maternal-fetal interface, where it abolishes maternal immune cell activity against fetus and establishes immune tolerance. Aberrant expression of HLA-G has been found in a variety of human neoplastic diseases. It plays an important role in the escape of tumor cells from immunosurveillance. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10577 Product name: Recombinant human HLA-G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-308 aa of BC021708 Sequence: SHSMRYFSAAVSRPSRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEREGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETKPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI Predict reactive species Full Name: major histocompatibility complex, class I, G Calculated Molecular Weight: 338 aa, 38 kDa Observed Molecular Weight: 33-45 kDa GenBank Accession Number: BC021708 Gene Symbol: HLA-G Gene ID (NCBI): 3135 RRID: AB_2878330 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17693 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924