Proteintech, 16954-1-AP, N6AMT2 Polyclonal antibody

Size: 20ul / 150ul The N6AMT2 (16954-1-AP) by Proteintech is a Polyclonal antibody targeting N6AMT2 in WB, ELISA applications with reactivity to human, mouse, rat samples 16954-1-AP targets N6AMT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, A431 cells, HEK-293 cells, mouse kidney tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10589 Product name: Recombinant human N6AMT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC018091 Sequence: MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI Predict reactive species Full Name: N-6 adenine-specific DNA methyltransferase 2 (putative) Calculated Molecular Weight: 214 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC018091 Gene Symbol: N6AMT2 Gene ID (NCBI): 221143 RRID: AB_2282277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVE0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.