Proteintech, 17002-1-AP, TBC1D23 Polyclonal antibody

Size: 20ul / 150ul The TBC1D23 (17002-1-AP) by Proteintech is a Polyclonal antibody targeting TBC1D23 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 17002-1-AP targets TBC1D23 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells Positive IP detected in: HepG2 cells Positive IHC detected in: human stomach cancer tissue, human kidney tissue, human liver tissue, human ovary tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TBC1D23, also named as NS4ATP1, is a gene down-regulated by Pneumocystis infection. Pneumocystis pneumonia is a common opportunistic disease in AIDS patients. (PMID: 20377877) Recently it has been found that TBC1D23 gene is the most frequently mutated in MSI-H cell lines and protein expressions of TBC1D23 in tumors with mutation were down regulated.(PMID: 20824714) This antibody is specific to TBC1D23. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10697 Product name: Recombinant human TBC1D23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC010221 Sequence: MLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSVDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRHVSSSDRVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHLLVTATHMYCLREIVSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES Predict reactive species Full Name: TBC1 domain family, member 23 Calculated Molecular Weight: 699 aa, 78 kDa Observed Molecular Weight: 70-78 kDa GenBank Accession Number: BC010221 Gene Symbol: TBC1D23 Gene ID (NCBI): 55773 RRID: AB_2240206 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.