Proteintech, 17015-1-AP, FAM65B Polyclonal antibody

Size: 20ul / 150ul The FAM65B (17015-1-AP) by Proteintech is a Polyclonal antibody targeting FAM65B in WB, ELISA applications with reactivity to human samples 17015-1-AP targets FAM65B in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FAM65B is also named as C6orf32, DIFF48, KIAA0386, PL48 and belongs to the FAM65 family.It has 2 isoforms produced by alternative splicing.Isoform 2 play a role in promoting myogenic cell differentiation, cytoskeletal rearrangement and filopodia formation(PMID:17150207). FAM65B is expressed in mononuclear cells, not in myotubes, upon induction of differentiation and cellular fusion, and expression is upregulated during human myoblast differentiation at both the mRNA and protein levels(PMID:17150207).This antibody is specific to the isoform of 119 kDa of FAM65B. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9991 Product name: Recombinant human FAM65B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 205-591 aa of BC001232 Sequence: SIKMKGLAGFARLCPGDQYEIFMKYGRQRWKLKGKIEVNGKQSWDGEETVFLPLIVGFISIKVTELKGLATHILVGSVTCETKELFAARPQVVAVDINDLGTIKLNLEITWYPFDVEDMTASSGAGNKAAALQRRMSMYSQGTPETPTFKDHSFFSNLPDDIFENGKAAEEKMPLSLSFSDLPNGDCALTSHSTGSPSNSTNPEITITPAEFNLSSLASQNEGMDDTSSASSRNSLGEGQEPKSHLKEEDPEEPRKPASAPSEACRRQSSGAGAEHLFLENDVAEALLQESEEASELKPVELDTSEGNITKQLVKRLTSAEVPMATDRLLSEGSVGGESEGCRSFLDGSLEDAFNGLLLALEPHKEQYKEFQDLNQEVMNLDDILKK Predict reactive species Full Name: family with sequence similarity 65, member B Calculated Molecular Weight: 118 kDa Observed Molecular Weight: 115 kDa, 66 kDa GenBank Accession Number: BC001232 Gene Symbol: FAM65B Gene ID (NCBI): 9750 RRID: AB_10640810 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4F9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.