Proteintech, 17024-1-AP, APCDD1 Polyclonal antibody

Size: 20ul / 150ul The APCDD1 (17024-1-AP) by Proteintech is a Polyclonal antibody targeting APCDD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 17024-1-AP targets APCDD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, Raji cells, mouse brain tissue, mouse heart tissue, mouse skin tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information APCDD1(adenomatosis polyposis coli down-regulated 1) is a membrane-bound glycoprotein conserved during vertebrate evolution that regulates important biological processes controlled by Wnt signaling (PMID: 26170146). APCDD1 is a membrane-bound glycoprotein that is abundantly expressed in human HFs (hair follicles) and can interact in vitro with WNT3A and LRP5, two essential components of Wnt signaling (PMID: 20393562). APCDD1 may be modified by glycosylation. Specification Tested Reactivity: human, mouse Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10303 Product name: Recombinant human APCDD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 141-496 aa of BC053324 Sequence: TEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPGRHTWSL Predict reactive species Full Name: adenomatosis polyposis coli down-regulated 1 Calculated Molecular Weight: 514 aa, 59 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC053324 Gene Symbol: APCDD1 Gene ID (NCBI): 147495 RRID: AB_3085513 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8J025 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.