Iright
BRAND / VENDOR: Proteintech

Proteintech, 17026-1-AP, GPR132 Polyclonal antibody

CATALOG NUMBER: 17026-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR132 (17026-1-AP) by Proteintech is a Polyclonal antibody targeting GPR132 in IHC, ELISA applications with reactivity to human, mouse, rat samples 17026-1-AP targets GPR132 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GPR132, also known as G2A (G2 accumulation protein), belongs to the G-protein coupled receptor (GPCR) 1 family. GPR132 is a DNA damage and stress inducible GPCR that blocks cells in G2/M. It functions at the G2/M checkpoint to delay mitosis and may serve as a mechanism for T and B cells and other cell types to slow their proliferation and repair damaged DNA to ensure proper replication (PMID: 9770487). Lysophosphatidylcholine (LPC) is a high affinity ligand for GPR132 (PMID: 15653487). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10325 Product name: Recombinant human GPR132 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 214-380 aa of BC084546 Sequence: IIAFTNHRIFRSIKQSMGLSAAQKAKVKHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMCGLEERLYTASVVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC Predict reactive species Full Name: G protein-coupled receptor 132 Calculated Molecular Weight: 380 aa, 43 kDa GenBank Accession Number: BC084546 Gene Symbol: GPR132 Gene ID (NCBI): 29933 RRID: AB_2113375 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924