Iright
BRAND / VENDOR: Proteintech

Proteintech, 17056-1-AP, UBE2F Polyclonal antibody

CATALOG NUMBER: 17056-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UBE2F (17056-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2F in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17056-1-AP targets UBE2F in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, Jurkat cells, mouse ovary tissue, rat ovary tissue Positive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information UBE2F(Ubiquitin-conjugating enzyme E2 F) is also named as NCE2(NEDD8-conjugating enzyme 2) and belongs to the ubiquitin-conjugating enzyme family.The canonical uBE2M catalyses the modification of most cullins, whereas uBE2F is specifically responsible for cuL5 neddylation. uBE2F is regulated differently than uBE2M, supporting the idea that neddylation is used to fine-tune ubiquitin-chain formation by different cullin-dependent E3s(PMID:19465892). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10764 Product name: Recombinant human UBE2F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC010549 Sequence: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR Predict reactive species Full Name: ubiquitin-conjugating enzyme E2F (putative) Calculated Molecular Weight: 185 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC010549 Gene Symbol: UBE2F Gene ID (NCBI): 140739 RRID: AB_2210295 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969M7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924