Iright
BRAND / VENDOR: Proteintech

Proteintech, 17069-1-AP, EIF5A1/EIF5A2 Polyclonal antibody

CATALOG NUMBER: 17069-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF5A1/EIF5A2 (17069-1-AP) by Proteintech is a Polyclonal antibody targeting EIF5A1/EIF5A2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 17069-1-AP targets EIF5A1/EIF5A2 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, A2780 cells, mouse testis tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human prostate cancer tissue, human colon cancer tissue, human stomach cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Eukaryotic initiation factor 5A (EIF5A) plays an essential role in the viability of eukaryotic cells. EIF5A is known to act as a translation initiation factor specific for a small number of mRNAs, a cellular target of HIV-1 REV protein, and an exportin-4-dependent nuclear export cargo. It is also involved in mRNA turnover and the establishment of actin polarity. [PMID:16157662]. EIF5A2, one isoform of EIF5A, has a key at the level of mRNA turnoverby acting downstream of decapping. It also involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity [PMID:14622290]. EIF5A2 shares 84% identity of amino acid sequence with EIF5A1 isoform, so EIF5A2 poly-antibody could recognize both EIF5A2 and EIF5A1. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10895 Product name: Recombinant human EIF5A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC036072 Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK Predict reactive species Full Name: eukaryotic translation initiation factor 5A2 Calculated Molecular Weight: 153 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC036072 Gene Symbol: EIF5A2 Gene ID (NCBI): 56648 RRID: AB_2262009 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924