Proteintech, 17076-1-AP, CST6 / Cystatin E/M Polyclonal antibody

Size: 20ul / 150ul The CST6 / Cystatin E/M (17076-1-AP) by Proteintech is a Polyclonal antibody targeting CST6 / Cystatin E/M in IHC, ELISA applications with reactivity to human, mouse samples 17076-1-AP targets CST6 / Cystatin E/M in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human breast cancer tissue, mouse skin tissue, mouse heart tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10965 Product name: Recombinant human CST6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-149 aa of BC031334 Sequence: ERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM Predict reactive species Full Name: cystatin E/M Calculated Molecular Weight: 149 aa, 17 kDa GenBank Accession Number: BC031334 Gene Symbol: CST6 Gene ID (NCBI): 1474 RRID: AB_2878345 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15828 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.