Proteintech, 17086-1-AP, PDPK1 Polyclonal antibody

Size: 20ul / 150ul The PDPK1 (17086-1-AP) by Proteintech is a Polyclonal antibody targeting PDPK1 in WB, IHC, ELISA applications with reactivity to human samples 17086-1-AP targets PDPK1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, LNCaP cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information 3-Phosphoinositide dependent protein kinase-1 (PDK1 or PDPK1) is a serine-threonine kinase belonging to AGC kinase family. PDK1 plays a critical role in establishing ACD (Asymmetric cell division) in the epithelium (PMID: 27184845). The kinase activity of PDK1 depends on phosphatidyl inositol 3-kinase (PI3K), a key intermediate in signaling pathways including those from growth factor receptors and adhesion molecules. Substrates of PDK1, including AKT and the protein kinase C (PKC) isozymes, regulate a number of essential cell functions (PMID: 20027184). PDPK1 has 5 isoforms produced by alternative splicing of 48~63 kDa and is detected as 60-63 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9213 Product name: Recombinant human PDPK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-556 aa of BC012103 Sequence: GKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ Predict reactive species Full Name: 3-phosphoinositide dependent protein kinase-1 Calculated Molecular Weight: 556 aa, 63 kDa Observed Molecular Weight: 60-63 kDa GenBank Accession Number: BC012103 Gene Symbol: PDPK1 Gene ID (NCBI): 5170 RRID: AB_2161289 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15530 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.