Proteintech, 17095-1-AP, TMEM5 Polyclonal antibody

Size: 20ul / 150ul The TMEM5 (17095-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM5 in WB, ELISA applications with reactivity to human, mouse, rat samples 17095-1-AP targets TMEM5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse ovary tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Transmembrane protein 5 (TMEM5) is associated with gonadal dysgenesis and neural tube defects. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10562 Product name: Recombinant human TMEM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-425 aa of BC013152 Sequence: TDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRTQYSFITGPAVIPGYFSVDVNNVVLILNGREKAKIFYATQWLLYAQNLVQIQKLQHLAVVLLGNEHCDNEWINPFLKRNGGFVELLFIIYDSPWINDVDVFQWPLGVATYRNFPVVEASWSMLHDERPYLCNFLGTIYENSSRQALMNILKKDGNDKLCWVSAREHWQPQETNESLKNYQDALLQSDLTLCPVGVNTECYRIYEACSYGSIPVVEDVMTAGNCGNTSVHHGAPLQLLKSMGAPFIFIKNWKELPAVLEKEKTIILQEKIERRKMLLQWYQHFKTEL Predict reactive species Full Name: transmembrane protein 5 Calculated Molecular Weight: 443 aa, 51 kDa Observed Molecular Weight: 45-51 kDa GenBank Accession Number: BC013152 Gene Symbol: TMEM5 Gene ID (NCBI): 10329 RRID: AB_2878349 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2B1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.