Iright
BRAND / VENDOR: Proteintech

Proteintech, 17105-1-AP, GNPDA2 Polyclonal antibody

CATALOG NUMBER: 17105-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GNPDA2 (17105-1-AP) by Proteintech is a Polyclonal antibody targeting GNPDA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17105-1-AP targets GNPDA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat kidney tissue, mouse kidney tissue Positive IHC detected in: human breast cancer tissue, human spleen tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GNPDA2(Glucosamine-6-phosphate deaminase 2) is also named as GNP2 and belongs to the glucosamine/galactosamine-6-phosphate isomerase family. It catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Human GNPDA1 and GNPDA2 shared the same fold and were predicted to form hexameric particles(PMID:12965206). This protein has 5 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 29 kDa, 23 kDa and 27 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10780 Product name: Recombinant human GNPDA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC015532 Sequence: MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN Predict reactive species Full Name: glucosamine-6-phosphate deaminase 2 Calculated Molecular Weight: 275 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC015532 Gene Symbol: GNPDA2 Gene ID (NCBI): 132789 RRID: AB_2878350 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDQ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924