Proteintech, 17116-1-AP, OMA1 Polyclonal antibody

Size: 20ul / 150ul The OMA1 (17116-1-AP) by Proteintech is a Polyclonal antibody targeting OMA1 in WB, IHC, ELISA applications with reactivity to human samples 17116-1-AP targets OMA1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, K-562 cells, HepG2 cells, SKOV-3 cells, MDA-MB-231 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information OMA1 (Overlapping with the m-AAA protease 1 homolog) is also named as MPRP1 (Metalloprotease-related protein 1) and belongs to the peptidase M48 family. It is a zinc metalloprotease that spans the inner mitochondrial membrane with a number of predicted membrane spanning domains and the 60 kDa form of OMA1 rapidly accumulated concomitantly with the cleavage of all OPA1 variants, the 40 kDa form of OMA1 may be the mature form (M-OMA1), and the 35 kDa is a cleaved form (S-OMA1), with the 60 kDa form being the active enzyme (PMID:20334834, 30518622). This antibody is speicific to OMA1. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10803 Product name: Recombinant human OMA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-524 aa of BC012915 Sequence: ICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS Predict reactive species Full Name: OMA1 homolog, zinc metallopeptidase (S. cerevisiae) Calculated Molecular Weight: 524 aa, 60 kDa Observed Molecular Weight: 34, 60 kDa GenBank Accession Number: BC012915 Gene Symbol: OMA1 Gene ID (NCBI): 115209 RRID: AB_2299053 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96E52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.