Iright
BRAND / VENDOR: Proteintech

Proteintech, 17141-1-AP, TRIT1 Polyclonal antibody

CATALOG NUMBER: 17141-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIT1 (17141-1-AP) by Proteintech is a Polyclonal antibody targeting TRIT1 in WB, ELISA applications with reactivity to human, mouse samples 17141-1-AP targets TRIT1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information IPTases (TRIT1) belong to a group of enzymes that modify both cytoplasmic and mitochondrial tRNAs of eukaryotic cells. Pathogenic mutations to human IPTase (TRIT1) cause mitochondrial insufficiency and neurodevelopmental disease, principally due to decreased modification of the mt-tRNA substrates.(PMID: 32324744, PMID: 36049610) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10906 Product name: Recombinant human TRIT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-467 aa of BC107569 Sequence: QVYEGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV Predict reactive species Full Name: tRNA isopentenyltransferase 1 Calculated Molecular Weight: 467 aa, 53 kDa Observed Molecular Weight: 53-60 kDa GenBank Accession Number: BC107569 Gene Symbol: TRIT1 Gene ID (NCBI): 54802 RRID: AB_3669261 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3H1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924