Iright
BRAND / VENDOR: Proteintech

Proteintech, 17155-1-AP, LRRC8A/SWELL1 Polyclonal antibody

CATALOG NUMBER: 17155-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LRRC8A/SWELL1 (17155-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC8A/SWELL1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 17155-1-AP targets LRRC8A/SWELL1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat lung tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LRRC8A, also named as SWELL1, KIAA1437, and LRRC8, belongs to the LRRC8 family. LRRC8A is the essential subunit of the volume-regulated anion channel (VRAC), a key regulator of cell volume homeostasis. It forms heteromeric channels with other LRRC8 family members (B-E) to transport chloride, organic osmolytes, and drugs. This channel is crucial for processes like regulatory volume decrease (RVD), cell proliferation, and migration. Dysfunction of LRRC8A-VRAC is implicated in cancer chemotherapy resistance, stroke, and immune disorders (PMID: 24790029, PMID: 39550567, PMID: 40642832). The molecular weight of LRRC8A is 94 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10062 Product name: Recombinant human LRRC8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 464-810 aa of BC051322 Sequence: SIAQLTGLKELWLYHTAAKIEAPALAFLRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQVVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFLPADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA Predict reactive species Full Name: leucine rich repeat containing 8 family, member A Calculated Molecular Weight: 810 aa, 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC051322 Gene Symbol: LRRC8A Gene ID (NCBI): 56262 RRID: AB_2918050 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924