Product Description
Size: 20ul / 150ul
The MRPS33 (17162-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS33 in WB, IF-P, ELISA applications with reactivity to human samples
17162-1-AP targets MRPS33 in WB, IF-P, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells
Positive IF-P detected in: mouse liver tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag10566 Product name: Recombinant human MRPS33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-106 aa of BC015462 Sequence: SSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK Predict reactive species
Full Name: mitochondrial ribosomal protein S33
Calculated Molecular Weight: 106 aa, 13 kDa
Observed Molecular Weight: 13-15 kDa
GenBank Accession Number: BC015462
Gene Symbol: MRPS33
Gene ID (NCBI): 51650
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y291
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924