Proteintech, 17167-1-AP, FANK1 Polyclonal antibody

Size: 20ul / 150ul The FANK1 (17167-1-AP) by Proteintech is a Polyclonal antibody targeting FANK1 in WB, ELISA applications with reactivity to human, mouse, rat samples 17167-1-AP targets FANK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information FANK1 (Fibronectin type 3 and ankyrin repeat domains protein 1), also known as HSD13. It is expected to be located in the nucleus. And mostly restricted to testis (PMID: 17604233). Fibronectin type III and ankyrin repeat domains 1(Fank1) is a nuclear protein expressed during the transition from the meiotic phase to the haploid phase of spermatogenesis. While little is known about the function of Fank1 during spermatogenesis, gene ontology analysis suggests that it may be a transcription factor. H. Wang explored the role of Fank1 using the yeast two-hybrid system to screen for cellular proteins that may interact with Fank1. In this screen, they identified the Jun activation domain-binding protein 1 (Jab1) as a potential Fank1-interacting protein (PMID: 20978819). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10639 Product name: Recombinant human FANK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-345 aa of BC024189 Sequence: MEPQRIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC Predict reactive species Full Name: fibronectin type III and ankyrin repeat domains 1 Calculated Molecular Weight: 345 aa, 38 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC024189 Gene Symbol: FANK1 Gene ID (NCBI): 92565 RRID: AB_3669264 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TC84 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.