Proteintech, 17172-1-AP, MT1X Polyclonal antibody

Size: 20ul / 150ul The MT1X (17172-1-AP) by Proteintech is a Polyclonal antibody targeting MT1X in IHC, ELISA applications with reactivity to human samples 17172-1-AP targets MT1X in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10711 Product name: Recombinant human MT1X protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-46 aa of BC032131 Sequence: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSECRAFPANLGDGPI Predict reactive species Full Name: metallothionein 1X Calculated Molecular Weight: 46 aa, 5 kDa GenBank Accession Number: BC032131 Gene Symbol: MT1X Gene ID (NCBI): 4501 RRID: AB_2878354 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: U3KQD7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.