Iright
BRAND / VENDOR: Proteintech

Proteintech, 17177-1-AP, DNAJB3 Polyclonal antibody

CATALOG NUMBER: 17177-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNAJB3 (17177-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17177-1-AP targets DNAJB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissue, human kidney tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10878 Product name: Recombinant human DNAJB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC024013 Sequence: MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily B, member 3 Calculated Molecular Weight: 145 aa, 17 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC024013 Gene Symbol: DNAJB3 Gene ID (NCBI): 414061 RRID: AB_2094420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924