Proteintech, 17178-1-AP, TNP1 Polyclonal antibody

Size: 20ul / 150ul The TNP1 (17178-1-AP) by Proteintech is a Polyclonal antibody targeting TNP1 in WB, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 17178-1-AP targets TNP1 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IF-P detected in: mouse testis tissue Positive IF-Fro detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information Transition nuclear proteins (TNP1 and TNP2) are the major nuclear proteins that replace somatic histones during spermatogenesis. TNPs are required for normal chromatin condensation and functional sperm development, spermatogenesis was found to be compromised in both Tnp1 and Tnp2 null mice. TNP1, or TP1, localized in nucleus, is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines. Recently, TNP-1 was used as a germ cell marker in condensing spermatids. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10890 Product name: Recombinant human TNP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC029516 Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL Predict reactive species Full Name: transition protein 1 (during histone to protamine replacement) Calculated Molecular Weight: 55 aa, 7 kDa Observed Molecular Weight: 6-10 kDa GenBank Accession Number: BC029516 Gene Symbol: TNP1 Gene ID (NCBI): 7141 RRID: AB_2206757 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09430 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.