Iright
BRAND / VENDOR: Proteintech

Proteintech, 17192-1-AP, Properdin/PFC Polyclonal antibody

CATALOG NUMBER: 17192-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Properdin/PFC (17192-1-AP) by Proteintech is a Polyclonal antibody targeting Properdin/PFC in WB, IHC, ELISA applications with reactivity to human samples 17192-1-AP targets Properdin/PFC in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information CFP, also named as Properdin or PFC, is a 469 amino acid protein, which contains 7 TSP type-1 domains. CFP as secreted protein is a positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. Properdin deficiency poses a significant risk for severe meningococcal infections (PMID: 22229731). Properdin may be novel biomarker for future risk of type 2 diabetes (PMID: 22338105). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9798 Product name: Recombinant human CFP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 120-469 aa of BC015756 Sequence: LEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL Predict reactive species Full Name: complement factor properdin Calculated Molecular Weight: 469 aa, 51 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC015756 Gene Symbol: CFP Gene ID (NCBI): 5199 RRID: AB_2878359 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P27918 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924