Proteintech, 17229-1-AP, KLHL18 Polyclonal antibody

Size: 20ul / 150ul The KLHL18 (17229-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL18 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17229-1-AP targets KLHL18 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, COLO 320 cells, HEK-293 cells, HeLa cells, HL-60 cells, mouse brain tissue Positive IHC detected in: human colon tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11070 Product name: Recombinant human KLHL18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-509 aa of BC032620 Sequence: YHLMPERRPHLPAFRTRPRCCTSIAGLIYAVGGLNSAGDSLNVVEVFDPIANCWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDCWTFMAPMACHEGGVGVGCIPLLTI Predict reactive species Full Name: kelch-like 18 (Drosophila) Calculated Molecular Weight: 509 aa, 56 kDa Observed Molecular Weight: 63 kDa, 56 kDa GenBank Accession Number: BC032620 Gene Symbol: KLHL18 Gene ID (NCBI): 23276 RRID: AB_10665554 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94889 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.