Proteintech, 17282-1-AP, EIF4E3 Polyclonal antibody

Size: 20ul / 150ul The EIF4E3 (17282-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4E3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17282-1-AP targets EIF4E3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, mouse heart tissue, HepG2 cells Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information EIF4E3, also known as Eukaryotic translation initiation factor 4E type 3, is a 224 amino acid protein, which recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis. EIF4E3 acts as a tissue-specific tumor suppressor. For instance, eIF4E3 inhibits expression of both mRNA export and translation targets of eIF4E1, consistent with its nuclear and cytoplasmic localization. Importantly, eIF4E3 overexpression represses oncogenic transformation. (PMID: 23587918). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11056 Product name: Recombinant human EIF4E3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC031289 Sequence: MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH Predict reactive species Full Name: eukaryotic translation initiation factor 4E family member 3 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24-30 kDa GenBank Accession Number: BC031289 Gene Symbol: EIF4E3 Gene ID (NCBI): 317649 RRID: AB_2262162 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.