Iright
BRAND / VENDOR: Proteintech

Proteintech, 17284-1-AP, HBZ Polyclonal antibody

CATALOG NUMBER: 17284-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HBZ (17284-1-AP) by Proteintech is a Polyclonal antibody targeting HBZ in WB, ELISA applications with reactivity to human, mouse, rat samples 17284-1-AP targets HBZ in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information HBZ, also named as Zeta-globin and HBAZ, belongs to the globin family. HBZ is an alpha-type chain of mammalian embryonic hemoglobin, synthesized primarily in the yolk sac. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11061 Product name: Recombinant human HBZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC027892 Sequence: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR Predict reactive species Full Name: hemoglobin, zeta Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC027892 Gene Symbol: HBZ Gene ID (NCBI): 3050 RRID: AB_2279419 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02008 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924