Proteintech, 17285-1-AP, SLC39A5 Polyclonal antibody

Size: 20ul / 150ul The SLC39A5 (17285-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17285-1-AP targets SLC39A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue, mouse pancreas tissue, rat kidney tissue, rat liver tissue, rat pancreas tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC39A5 (Zip5) belongs to the ZIP family of metal ion transporters which function to transport zinc and/or other metal ion substrates from the extracellular space or organellar lumen into the cytoplasm. Most of ZIP members have eight predicted transmembrane domains and similar predicted topologies with the N- and C-termini of the protein located on the extracytoplasmic face of the membrane. Zip5 is a zinc uptake transporter that is specific for Zn(II) over other potential metal ion substrates. ZIP5 gene is most actively expressed in tissues involved in zinc homeostasis (intestine, visceral endoderm, pancreas) but is not induced during zinc deficiency. ZIP5 is localized to the basolateral surface of these cells under zinc-replete conditions but is internalized during periods of dietary zinc deficiency. These observations suggest that Zip5 plays a central role in controlling organismal zinc status. This antibody was generated against the N-terminal region of human SLC39A5 and is predicted to detect the endogenous level of SLC39A5 protein. The calculated molecular weight of SLC39A5 is 56 kDa. With glycosylation modification, the molecular weight of SLC39A5 will be migrated to 70 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11067 Product name: Recombinant human SLC39A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-215 aa of BC027884 Sequence: GSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQS Predict reactive species Full Name: solute carrier family 39 (metal ion transporter), member 5 Calculated Molecular Weight: 539 aa, 56 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC027884 Gene Symbol: SLC39A5 Gene ID (NCBI): 283375 RRID: AB_2923566 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZMH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.