Iright
BRAND / VENDOR: Proteintech

Proteintech, 17331-1-AP, DNAJC11 Polyclonal antibody

CATALOG NUMBER: 17331-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNAJC11 (17331-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17331-1-AP targets DNAJC11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, SH-SY5Y cells, HepG2 cells, mouse liver tissue Positive IHC detected in: human liver tissue, human skeletal muscle tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DNAJC11 is a member of the J proteins also known as HSP40 family of co-chaperones. Recently DNAJC11 has been found to interact with mitofilin, a mitochondrial inner membrane protein, indicating that it may be a molecular chaperone during mitochondrial protein import and folding. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11310 Product name: Recombinant human DNAJC11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-507 aa of BC014145 Sequence: MHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFALRRVTSAKGWGELEFGAGDLQGPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPGLTTVLARNLDKNTVGYLQWRWGIQSAMNTSIVRDTKTSHFTVALQLGIPHSFALISYQHKFQDDDQTRVKGSLKAGFFGTVVEYGAERKISRHSVLGAAVSVGVPQGVSLKVKELEKQRESAATDVLQKKQEAESAVRLMQESVRRIIEAEESRMGLIIVNAWYGKFVNDKSRKSEKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDPCVGEEKNLKVLYQFRGVLHQVMVLDSEALRIPKQSHRIDTDG Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 11 Calculated Molecular Weight: 507 aa, 57 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC014145 Gene Symbol: DNAJC11 Gene ID (NCBI): 55735 RRID: AB_2878385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVH1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924