Proteintech, 17334-1-AP, ACTR8 Polyclonal antibody

Size: 20ul / 150ul The ACTR8 (17334-1-AP) by Proteintech is a Polyclonal antibody targeting ACTR8 in WB, ELISA applications with reactivity to human samples 17334-1-AP targets ACTR8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11367 Product name: Recombinant human ACTR8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC032744 Sequence: MILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRIFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDGLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQRFGVRMLRERAAFVW Predict reactive species Full Name: ARP8 actin-related protein 8 homolog (yeast) Calculated Molecular Weight: 329 aa, 37 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC032744 Gene Symbol: ACTR8 Gene ID (NCBI): 93973 RRID: AB_3076387 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.