Proteintech, 17347-1-AP, SDR42E1 Polyclonal antibody

Size: 20ul / 150ul The SDR42E1 (17347-1-AP) by Proteintech is a Polyclonal antibody targeting SDR42E1 in ELISA applications with reactivity to human samples 17347-1-AP targets SDR42E1 in ELISA applications and shows reactivity with human samples. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11391 Product name: Recombinant human SDR42E1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-364 aa of BC019670 Sequence: MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQDADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDS Predict reactive species Full Name: short chain dehydrogenase/reductase family 42E, member 1 Calculated Molecular Weight: 383 aa, 43 kDa GenBank Accession Number: BC019670 Gene Symbol: SDR42E1 Gene ID (NCBI): 93517 RRID: AB_2878393 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.