Proteintech, 17348-1-AP, SLC25A18 Polyclonal antibody

Size: 20ul / 150ul The SLC25A18 (17348-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A18 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 17348-1-AP targets SLC25A18 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse kidney tissue, mouse heart tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC25A18, also named as GC 2, belongs to the mitochondrial transporter family (SLC25). It is located in inner mitochondrial membrane which involved in the transport of glutamate either with H+or in exchange for OH-. SLC25A18 is highly expressed in brain, testis, lung, kidney, liver, spleen and skeletal muscle. 17348-1-AP antibody detects the band around 32-35 kDa in SDS-PAGE.   (PMID: 14598172) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11420 Product name: Recombinant human SLC25A18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-228 aa of BC031644 Sequence: LAKTRLQNQHGKAMYKGMIDCLMKTARAEGFFGMYRGAAVNLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVTCPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKASFAHSFVSG Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier), member 18 Calculated Molecular Weight: 315 aa, 34 kDa Observed Molecular Weight: 32-35 kDa GenBank Accession Number: BC031644 Gene Symbol: SLC25A18 Gene ID (NCBI): 83733 RRID: AB_2189889 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H1K4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.