Iright
BRAND / VENDOR: Proteintech

Proteintech, 17364-1-AP, DNAJC5B Polyclonal antibody

CATALOG NUMBER: 17364-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNAJC5B (17364-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC5B in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17364-1-AP targets DNAJC5B in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information DNAJC5B encodes cysteine string proteins (CSP) beta. CSPs belong to the DnaJ-like chaperone family and play an important role in regulated exocytosis in neurons and endocrine cells. Mammals express three CSP proteins, α, β, γ. In contrast to the CSPα which is ubiquitously expressed, CSPβ is restricted to testis and auditory hair cell neurons. The predicted MW of DNAJC5B is around 22 kDa, while some modified forms exist (PMID: 17034881) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10744 Product name: Recombinant human DNAJC5B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-199 aa of BC016742 Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 5 beta Calculated Molecular Weight: 199 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC016742 Gene Symbol: DNAJC5B Gene ID (NCBI): 85479 RRID: AB_2095062 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UF47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924