Iright
BRAND / VENDOR: Proteintech

Proteintech, 17410-1-AP, RIOK2 Polyclonal antibody

CATALOG NUMBER: 17410-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RIOK2 (17410-1-AP) by Proteintech is a Polyclonal antibody targeting RIOK2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 17410-1-AP targets RIOK2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, HCT 116 cells Positive IHC detected in: mouse brain tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Rio-kinase 2 (RIOK2) is an atypical serine-threonine kinase that participates in the nuclear export and maturation steps of the pre-40S ribosomal complex to facilitate cytoplasmic translation. RIOK2 binds the pre-40S subunit and promotes its nuclear export by interaction with the CRM1 chaperone protein (PMID: 36661680, 28499923). High expression of RIOK2 has been linked to decreased overall survival in non-small cell lung cancer.. RIOK2's kinase activ DD-RIPK1-caspase-8 complex from lysosome to ER (PMID: 41249793). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9975 Product name: Recombinant human RIOK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-553 aa of BC000953 Sequence: QMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGSENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEKNRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWGE Predict reactive species Full Name: RIO kinase 2 (yeast) Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC000953 Gene Symbol: RIOK2 Gene ID (NCBI): 55781 RRID: AB_2178093 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVS4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924